PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D11G2061
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 360aa    MW: 40344.1 Da    PI: 6.51
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D11G2061genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.31.1e-151462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+ ++++ G+g +W + ++++g++R++k+c++rw++yl
      Gh_D11G2061 14 KGPWSPEEDAKLKAYIEENGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding39.61.2e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g++++eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
      Gh_D11G2061  69 GAFSEEEDNIICSLYINIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      79*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.234962IPR017930Myb domain
SuperFamilySSF466895.01E-2611109IPR009057Homeodomain-like
SMARTSM007173.7E-121364IPR001005SANT/Myb domain
PfamPF002498.1E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.0E-241569IPR009057Homeodomain-like
CDDcd001676.84E-91662No hitNo description
PROSITE profilePS5129422.60963117IPR017930Myb domain
SMARTSM007172.8E-1167115IPR001005SANT/Myb domain
PfamPF002492.3E-1169111IPR001005SANT/Myb domain
CDDcd001678.57E-870113No hitNo description
Gene3DG3DSA:1.10.10.605.5E-2470117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDAKLKAYIE ENGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGA FSEEEDNIIC SLYINIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLGK  120
QRKEQQARRA SWLTVKQEMK REGGDYMLPG MVSQPPYWPQ QLPVIPFTTT TNQDPPLPND  180
QESIKNLLIK LGGRFSDDHH PQSSTSTPIP NSMNSSRYPL DVSFAQDQLY ENSMNNTVSP  240
ASSISPINST CSQVTNGTHF NTNEVAVPND MFQGLDGFTD ELRELTYSNN QQIMNWLEGF  300
YGTDNTVDGS STTGSSSVES SSWGPIYSLG FPQLVTGFEP CQQNMPQAST YGEQYCTWAV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-23141177108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00089SELEXTransfer from AT3G49690Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0527200.0KM052720.1 Gossypium hirsutum RAX-like transcription factor RAX1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012492025.10.0PREDICTED: transcription factor RAX3-like isoform X2
RefseqXP_012492024.10.0PREDICTED: transcription factor RAX3-like isoform X1
SwissprotQ9M2Y92e-85RAX3_ARATH; Transcription factor RAX3
TrEMBLA0A089N7K20.0A0A089N7K2_G
STRINGVIT_00s1352g00010.t011e-138(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29412568
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.12e-76myb domain protein 84